PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 585aa    MW: 63747.6 Da    PI: 4.7558
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024549.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.81.1e-1382185781374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv++L++cAeav++++l+la+al++++  la+++  +m+++a+yf+eALa+r++r    +y    p++  +++ s+ l +   f+e++P+lkf+h+ta
  Pbr024549.1 218 LVHTLMACAEAVQQENLKLADALVKHVGLLAASQTGAMRKVATYFAEALARRIYR----IY----PQDCLDSSYSDILEM--HFYETCPYLKFAHFTA 305
                  689****************************************************....44....444443335555544..5*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIlea+++++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+fef+ +va++l+dl++++L++
  Pbr024549.1 306 NQAILEAFATARRVHVIDFGLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAETIGVEFEFRGFVANSLADLTPSMLDI 403
                  ************************************************************************************************** PP

         GRAS 197 kp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +p   E++aVn+v++lhrll++++++++    vL+ +k ++Pk+v++veqea+hn++ Fl+rf+eal+yys lfdsle +  +  +++ ++++++lgr
  Pbr024549.1 404 RPsdVEVVAVNSVFELHRLLARPGAVDK----VLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGS--SGPSQDLVMSEVYLGR 495
                  **999***************99999988....*********************************************999..566999********** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +i+nv aceg +r+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++gsl+lgW++rpL+++SaW+
  Pbr024549.1 496 QICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENNGSLMLGWHTRPLIATSAWQ 578
                  **********************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120414.7E-3452116IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.5E-3652124No hitNo description
PROSITE profilePS5098567.825192557IPR005202Transcription factor GRAS
PfamPF035143.7E-136218578IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MKRDHRESCA TVTARQNNSK PEYSSPPSSA LNGKAKIWED DQDGYSAGGD MDELLAVLGY  60
KVRSDDMADV AEKLEQLEMV MGSAQEDGIS QLSDTVHYNP SDLSGWVQSM LSELNTGDDM  120
PSIDDPLLVP AQSSSITSMS FSNSQRSRVF SDDSEYDLRA IPGVAASPPA YSPSDTESTR  180
KRLKASIGSD SNGSSSGAVS DPTRPRVLVD SQETGVRLVH TLMACAEAVQ QENLKLADAL  240
VKHVGLLAAS QTGAMRKVAT YFAEALARRI YRIYPQDCLD SSYSDILEMH FYETCPYLKF  300
AHFTANQAIL EAFATARRVH VIDFGLKQGM QWPALMQALA LRPGGPPAFR LTGIGPPQPD  360
NTDALQQVGW KLAQLAETIG VEFEFRGFVA NSLADLTPSM LDIRPSDVEV VAVNSVFELH  420
RLLARPGAVD KVLSSIKAMK PKIVTIVEQE ANHNGPVFLD RFTEALHYYS NLFDSLEGSS  480
GPSQDLVMSE VYLGRQICNV MACEGGDRVE RHETLSQWRG RMDSAGFDPV HLGSNAFKQA  540
SMLLALFAGG DGYRVEENNG SLMLGWHTRP LIATSAWQLA STTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-552185784375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0078840.0DQ007884.1 Malus x domestica DELLA protein (RGL2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334448.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLH2EII90.0H2EII9_MALDO; Spur-type DELLA protein
STRINGPOPTR_0005s14540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2